PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009630533.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 166aa    MW: 19136.7 Da    PI: 9.9681
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009630533.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.4e-3287145159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk++++prsYY+Ct++gC+vkk+v+r ++d+ vv++tYeg H+h+
  XP_009630533.1  87 LDDGYRWRKYGQKAVKNNNYPRSYYKCTHQGCNVKKQVQRLSKDEGVVVTTYEGMHTHP 145
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-3472145IPR003657WRKY domain
SuperFamilySSF1182908.76E-3079146IPR003657WRKY domain
PROSITE profilePS5081130.10282147IPR003657WRKY domain
SMARTSM007741.1E-3887146IPR003657WRKY domain
PfamPF031062.0E-2688145IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MENQWMPFLG STCCYNSMNG WISGLKTENS NSTAREQHVS NIKHSPVGVV SSETHTTNII  60
SSLKKKGDKK IKKPRFAFQT RSQVDILDDG YRWRKYGQKA VKNNNYPRSY YKCTHQGCNV  120
KKQVQRLSKD EGVVVTTYEG MHTHPIDKPT DNFEQILHQM HIIPPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2877146776Probable WRKY transcription factor 4
2lex_A2e-2877146776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754416e-52HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755146e-52HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630533.11e-124PREDICTED: probable WRKY transcription factor 43
RefseqXP_016444143.11e-124PREDICTED: probable WRKY transcription factor 43
SwissprotQ9S7639e-52WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBLK4BDM27e-63K4BDM2_SOLLC; Uncharacterized protein
STRINGSolyc02g094270.1.12e-62(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22042461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01970.12e-52WRKY DNA-binding protein 45